Micron Document




Ageing
──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────
top
Ageing (or aging in American English) is the process of becoming older until death. The term refers mainly to humans, many other animals, and fungi; whereas for example, bacteria, perennial plants and some simple animals are potentially biologically immortal. In a broader sense, ageing can refer to single cells within an organism which have ceased dividing, or to the population of a species.cite-ref-1[1]

In humans, ageing represents the accumulation of changes in a human being over time and can encompass physical, psychological, and social changes.cite-ref-2[2]cite-ref-3[3] Reaction time, for example, may slow with age, while memories and general knowledge typically increase. Of the roughly 150,000 people who die each day across the globe, about two-thirds die from age-related causes.cite-ref-4[4]

Current ageing theories are assigned to the damage concept, whereby the accumulation of damage (such as DNA oxidation) may cause biological systems to fail, or to the programmed ageing concept, whereby the internal processes (epigenetic maintenance such as DNA methylation)cite-ref-5[5] inherently may cause ageing. Programmed ageing should not be confused with programmed cell death (apoptosis).

Contents

Diet

──────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────────

Ageing versus immortality

Human beings and members of other species, especially animals, age and die. Fungi, too, can age.cite-ref-mortimer-1959-6-0[6] In contrast, many species can be considered potentially immortal: for example, bacteria fission to produce daughter cells, strawberry plants grow runners to produce clones of themselves, and animals in the genus Hydra have a regenerative ability by which they avoid dying of old age.

Early life forms on Earth, starting at least 3.7 billion years ago,cite-ref-nutman-2016-7-0[7] were single-celled organisms. Such organisms (Prokaryotes, Protozoans, algae) multiply by fission into daughter cells; thus single celled organisms have been thought to not age and to be potentially immortal under favorable conditions.cite-ref-rose1991-8-0[8]cite-ref-partridge1993-9-0[9] However, evidence has been reported that aging leading to death occurs in the single-cell bacterium Escherichia coli, an organism that reproduces by morphologically symmetrical division.cite-ref-stewart2005-10-0[10] Evidence of aging has also been reported for the bacterium Caulobacter crescintus.cite-ref-11[11] and the single cell yeast Saccharomyces cerevisiae.cite-ref-12[12]cite-ref-13[13]

Ageing and mortality of the individual organism became more evident with the evolution of eukaryotic sexual reproduction,cite-ref-williams1957-14-0[14] which occurred with the emergence of the fungal/animal kingdoms approximately a billion years ago, and the evolution of seed-producing plants 320 million years ago. The sexual organism could henceforth pass on some of its genetic material to produce new individuals and could itself become disposable with respect to the survival of its species.cite-ref-williams1957-14-1[14] This classic biological idea has however been perturbed recently by the discovery that the bacterium E. coli may split into distinguishable daughter cells, which opens the theoretical possibility of "age classes" among bacteria.cite-ref-stewart2005-10-1[10]

Even within humans and other mortal species, there are cells with the potential for immortality: cancer cells which have lost the ability to die when maintained in a cell culture such as the HeLa cell line,cite-ref-pereirasmith1992-15-0[15] and specific stem cells such as germ cells (producing ova and spermatozoa).cite-ref-forster-2015-16-0[16] In artificial cloning, adult cells can be rejuvenated to embryonic status and then used to grow a new tissue or animal without ageing.cite-ref-wakayama-2013-17-0[17] Normal human cells however die after about 50 cell divisions in laboratory culture (the Hayflick Limit, discovered by Leonard Hayflick in 1961).cite-ref-pereirasmith1992-15-1[15]

Symptoms

A number of characteristic ageing symptoms are experienced by a majority, or by a significant proportion of humans during their lifetimes.

• Teenagers lose the young child's ability to hear high-frequency sounds above 20 kHz.cite-ref-hifreqaudiometry2014-18-1[18]
Wrinkles develop mainly due to photoageing, particularly affecting sun-exposed areas such as the face.cite-ref-thurstan-2012-22-0[22]
• After age 30, the mass of the human body is decreased until 70 years and then shows damping oscillations.cite-ref-age-dynamics-21-1[21]
• People over 35 years of age are at increasing risk for losing strength in the ciliary muscle of the eyes, which leads to difficulty focusing on close objects, or presbyopia.cite-ref-24[24]cite-ref-weale-2003-25-0[25] Most people experience presbyopia by age 45–50.cite-ref-truscott-2009-26-0[26] The cause is lens hardening by decreasing levels of alpha-crystallin, a process which may be sped up by higher temperatures.cite-ref-truscott-2009-26-1[26]cite-ref-27[27]
• Around age 55, hair turns grey.cite-ref-28[28] Pattern hair loss by the age of 55 affects about 30–50% of malescite-ref-29[29] and a quarter of females.cite-ref-var2015-30-0[30]
Menopause typically occurs between 44 and 58 years of age.cite-ref-31[31]
• In the 60–64 age cohort, the incidence of osteoarthritis rises to 53%. Only 20%, however, report disabling osteoarthritis at this age.cite-ref-thomas2014-32-0[32]
• Almost half of people older than 75 have hearing loss (presbycusis), inhibiting spoken communication.cite-ref-33[33] Many vertebrates such as fish, birds and amphibians do not develop presbycusis in old age, as they are able to regenerate their cochlear sensory cells; mammals, including humans, have genetically lost this ability.cite-ref-rubel2013-34-0[34]
• By age 80, more than half of all Americans either have a cataract or have had cataract surgery.cite-ref-nih2009-35-0[35]
Frailty, a syndrome of decreased strength, physical activity, physical performance and energy, affects 25% of those over 85.cite-ref-fried-2001-36-0[36]cite-ref-37[37] Muscles have a reduced capacity of responding to exercise or injury and loss of muscle mass and strength (sarcopenia) is common.cite-ref-38[38] Maximum oxygen use and maximum heart rate decline.cite-ref-39[39] Hand strength and mobility decrease.cite-ref-40[40]
Atherosclerosis is classified as an ageing disease.cite-ref-wang-2012-41-0[41] It leads to cardiovascular disease (for example, stroke and heart attacks),cite-ref-wang-2016-42-0[42] which, globally, is the most common cause of death.cite-ref-43[43] Vessel ageing causes vascular remodelling and loss of arterial elasticity, and as a result, causes the stiffness of the vasculature.cite-ref-wang-2012-41-1[41]
• Evidence suggests that age-related risk of death plateaus after the age of 105.cite-ref-44[44] The maximum human lifespan is suggested to be 115 years.cite-ref-nyt-20161005-45-0[45]cite-ref-nat-20151005-46-0[46] The oldest reliably recorded human was Jeanne Calment, who died in 1997 at 122.

Dementia becomes more common with age.cite-ref-larson2013-47-0[47] About 3% of people between the ages of 65 and 74, 19% of those between 75 and 84, and nearly half of those over 85 years old have dementia.cite-ref-48[48] The spectrum ranges from mild cognitive impairment to the neurodegenerative diseases of Alzheimer's disease, cerebrovascular disease, Parkinson's disease and Lou Gehrig's disease. Furthermore, many types of memory decline with ageing, but not semantic memory or general knowledge such as vocabulary definitions. These typically increase or remain steady until late adulthood cite-ref-schaie2005-49-0[49] (see Ageing brain). Intelligence declines with age, though the rate varies depending on the type and may, in fact, remain steady throughout most of the human lifespan, dropping suddenly only as people near the end of their lives. Individual variations in the rate of cognitive decline may therefore be explained in terms of people having different lengths of life.cite-ref-stuart-50-0[50] There are changes to the brain: after 20 years of age, there is a 10% reduction each decade in the total length of the brain's myelinated axons.cite-ref-marner-51-0[51]cite-ref-52[52]

Age can result in visual impairment, whereby non-verbal communication is reduced,cite-ref-53[53] which can lead to isolation and possible depression. Older adults, however, may not experience depression as much as younger adults, and were paradoxically found to have improved mood, despite declining physical health.cite-ref-54[54] Macular degeneration causes vision loss and increases with age, affecting nearly 12% of those above the age of 80.cite-ref-meh2015-55-0[55] This degeneration is caused by systemic changes in the circulation of waste products and by the growth of abnormal vessels around the retina.cite-ref-nussbaum-j-f-1989-56-0[56]

Other visual diseases that often appear with age are cataracts and glaucoma. A cataract occurs when the lens of the eye becomes cloudy, making vision blurry; it eventually causes blindness if untreated.cite-ref-57[57] They develop over time and are seen most often with those that are older. Cataracts can be treated through surgery. Glaucoma is another common visual disease that appears in older adults. Glaucoma is caused by damage to the optic nerve, causing vision loss.cite-ref-nei-nih-gov-58-0[58] Glaucoma usually develops over time, but there are variations to glaucoma, and some have a sudden onset. There are a few procedures for glaucoma, but there is no cure or fix for the damage, once it has occurred. Prevention is the best measure in the case of glaucoma.cite-ref-nei-nih-gov-58-1[58]

In addition to physical symptoms, aging can also cause a number of mental health issues as older adults deal with challenges such as the death of loved ones, retirement and loss of purpose, as well as their own health issues. Some warning signs are: changes in mood or energy, changes in sleep or eating habits, pain, sadness, unhealthy coping mechanisms such as smoking, suicidal ideations, and others. Older Adult Mental Health Older adults are more prone to social isolation as well, which can further increase the risk for physical and mental conditions such as anxiety, depression, and cognitive decline. Social isolation, loneliness in older people pose health risks

A distinction can be made between "proximal ageing" (age-based effects that come about because of factors in the recent past) and "distal ageing" (age-based differences that can be traced to a cause in a person's early life, such as childhood poliomyelitis).cite-ref-stuart-50-1[50]

Ageing is among the greatest known risk factors for most human diseases. Of the roughly 150,000 people who die each day across the globe, about two-thirds--100,000 per day--die from age-related causes.cite-ref-de-grey-2007-59-0[59] In industrialized nations, the proportion is higher, reaching 90%.cite-ref-de-grey-2007-59-1[59]cite-ref-lopez-2006-60-0[60]cite-ref-61[61]

Biological basis

In the 21st century, researchers are only beginning to investigate the biological basis of ageing even in relatively simple and short-lived organisms, such as yeast.cite-ref-janssens-2015-62-0[62] Little is known of mammalian ageing, in part due to the much longer lives of even small mammals, such as the mouse (around 3 years). A model organism for the study of ageing is the nematode C. elegans – having a short lifespan of 2–3 weeks – enabling genetic manipulations or suppression of gene activity with RNA interference, and other factors.cite-ref-rothmansingson2012-63-0[63] Most known mutations and RNA interference targets that extend lifespan were first discovered in C. elegans.cite-ref-reis2009-64-0[64]

The factors proposed to influence biological ageing fall into two main categories, programmed and error-related.cite-ref-jin-2010-65-0[65] Programmed factors follow a biological timetable that might be a continuation of inherent mechanisms that regulate childhood growth and development.cite-ref-jin-2010-65-1[65] This regulation would depend on changes in gene expression that affect the systems responsible for maintenance, repair and defense responses.cite-ref-jin-2010-65-2[65] Factors causing errors or damage include internal and environmental events that induce cumulative deterioration in one or more organs.cite-ref-jin-2010-65-3[65]

Programmed factors

The rate of ageing varies substantially across different species, and this, to a large extent, is genetically based. For example, numerous perennial plants ranging from strawberries and potatoes to willow trees typically produce clones of themselves by vegetative reproduction and are thus potentially immortal, while annual plants such as wheat and watermelons die each year and reproduce by sexual reproduction. In 2008 it was discovered that inactivation of only two genes in the annual plant Arabidopsis thaliana leads to its conversion into a potentially immortal perennial plant.cite-ref-66[66] The oldest animals known so far are 15,000-year-old Antarctic sponges,cite-ref-bbc2017-oldestlivingthing-67-0[67] which can reproduce both sexually and clonally.

Clonal immortality apart, there are certain species whose individual lifespans stand out among Earth's life-forms, including the bristlecone pine at 5062 yearscite-ref-oldest-68-0[68] or 5067 years,cite-ref-bbc2017-oldestlivingthing-67-1[67] invertebrates like the hard clam (known as quahog in New England) at 508 years,cite-ref-sosnowska2014-69-0[69] the Greenland shark at 400 years,cite-ref-nielsen2016-70-0[70] various deep-sea tube worms at over 300 years,cite-ref-durkin2017-71-0[71] fish like the sturgeon and the rockfish, and the sea anemonecite-ref-72[72] and lobster.cite-ref-73[73]cite-ref-74[74] Such organisms are sometimes said to exhibit negligible senescence.cite-ref-75[75] The genetic aspect has also been demonstrated in studies of human centenarians.

Midlife Acceleration

A 2025 study published in Cell examined protein changes in 516 tissue samples collected from 76 human donors ranging in age from 14 to 68. Researchers developed tissue-specific “proteomic clocks” to trace how ageing progresses across different organs. Their analysis revealed a noticeable shift in the rate of ageing around age 50, with the steepest changes occurring between ages 45 and 55—particularly in blood vessels.cite-ref-76[76]cite-ref-77[77]cite-ref-78[78]

Among the various tissues studied, the aorta showed the most significant changes in protein makeup. One of the proteins identified, GAS6, was linked to faster ageing; when introduced into mice, it triggered early vascular deterioration and other signs of systemic ageing.cite-ref-79[79] The research also found that some organs, like the adrenal gland, begin showing ageing-related changes as early as age 30,cite-ref-80[80] suggesting that not all parts of the body age at the same pace. The findings suggest that human ageing accelerates midlife rather than progressing steadily throughout adulthood. Understanding this shift could help guide earlier and more targeted approaches to support healthier ageingcite-ref-81[81]cite-ref-82[82]

Evolution of ageing

Life span, like other phenotypes, is selected for in evolution. Traits that benefit early survival and reproduction will be selected for even if they contribute to an earlier death. Such a genetic effect is called the antagonistic pleiotropy effect when referring to a gene (pleiotropy signifying the gene has a double function – enabling reproduction at a young age but costing the organism life expectancy in old age) and is called the disposable soma effect when referring to an entire genetic programme (the organism diverting limited resources from maintenance to reproduction).cite-ref-williams1957-14-2[14] The biological mechanisms which regulate lifespan probably evolved with the first multicellular organisms more than a billion years ago.cite-ref-reis2009-64-1[64] However, even single-celled organisms such as yeast have been used as models in ageing, hence ageing has its biological roots much earlier than multi-cellularity.cite-ref-83[83]

Damage-related factors

DNA damage theory of ageing: DNA damage is thought to be the common basis of both cancer and ageing, and it has been argued that intrinsic causes of DNA damage are the most important causes of ageing.cite-ref-84[84]cite-ref-85[85] Genetic damage (aberrant structural alterations of the DNA), mutations (changes in the DNA sequence), and epimutations (methylation of gene promoter regions or alterations of the DNA scaffolding which regulate gene expression), can cause abnormal gene expression. DNA damage causes the cells to stop dividing or induces apoptosis, often affecting stem cell pools and therefore hindering regeneration. However, lifelong studies of mice suggest that most mutations happen during embryonic and childhood development, when cells divide often, as each cell division is a chance for errors in DNA replication.cite-ref-86[86] A meta analysis study of 36 studies with 4,676 participants showed an association between age and DNA damage in humans.cite-ref-87[87] In the human hematopoietic stem cell compartment DNA damage accumulates with age.cite-ref-88[88] In healthy humans after 50 years of age, chronological age shows a linear association with DNA damage accumulation in blood mononuclear cells.cite-ref-89[89] Genome-wide profiles of DNA damage can be used as highly accurate predictors of mammalian age.cite-ref-90[90]
Genetic instability: Dogs annually lose approximately 3.3% of the DNA in their heart muscle cells while humans lose approximately 0.6% of their heart muscle DNA each year. These numbers are close to the ratio of the maximum longevities of the two species (120 years vs. 20 years, a 6/1 ratio). The comparative percentage is also similar between the dog and human for yearly DNA loss in the brain and lymphocytes. As stated by lead author, Bernard L. Strehler, "... genetic damage (particularly gene loss) is almost certainly (or probably the) central cause of ageing."cite-ref-91[91]
• Accumulation of waste:

• A buildup of waste products in cells presumably interferes with metabolism. For example, a waste product called lipofuscin is formed by a complex reaction in cells that binds fat to proteins. Lipofuscin may accumulate in the cells as small granules during ageing.cite-ref-92[92]
• The hallmark of ageing yeast cells appears to be overproduction of certain proteins.cite-ref-janssens-2015-62-1[62]
Autophagy induction can enhance clearance of toxic intracellular waste associated with neurodegenerative diseases and has been comprehensively demonstrated to improve lifespan in yeast, worms, flies, rodents and primates. The situation, however, has been complicated by the identification that autophagy up-regulation can also occur during ageing.cite-ref-carroll-2013-93-0[93]

• Wear-and-tear theory: The general idea that changes associated with ageing are the result of chance damage that accumulates over time.cite-ref-jin-2010-65-4[65]
• Accumulation of errors: The idea that ageing results from chance events that escape proofreading mechanisms, which gradually damages the genetic code.
Heterochromatin loss, model of ageing.cite-ref-94[94]cite-ref-95[95]
• Cross-linkage: The idea that ageing results from accumulation of cross-linked compounds that interfere with normal cell function.cite-ref-96[96]
• Studies of mtDNA mutator mice have shown that increased levels of somatic mtDNA mutations directly can cause a variety of ageing phenotypes. The authors propose that mtDNA mutations lead to respiratory-chain-deficient cells and thence to apoptosis and cell loss. They cast doubt experimentally however on the common assumption that mitochondrial mutations and dysfunction lead to increased generation of reactive oxygen species (ROS).cite-ref-97[97]
Free-radical theory: Damage by free radicals, or more generally reactive oxygen species or oxidative stress, create damage that may give rise to the symptoms we recognise as ageing.cite-ref-98[98] The effect of calorie restriction may be due to increased formation of free radicals within the mitochondria, causing a secondary induction of increased antioxidant defence capacity.cite-ref-99[99]
Mitochondrial theory of ageing: free radicals produced by mitochondrial activity damage cellular components, leading to ageing.
DNA oxidation and caloric restriction: Caloric restriction reduces 8-OH-dG DNA damage in organs of ageing rats and mice.cite-ref-pmid11517304-100-0[100]cite-ref-pmid15763395-101-0[101] Thus, reduction of oxidative DNA damage is associated with a slower rate of ageing and increased lifespan.cite-ref-102[102] In a 2021 review article, Vijg stated that "Based on an abundance of evidence, DNA damage is now considered as the single most important driver of the degenerative processes that collectively cause ageing."cite-ref-vijg-103-0[103]

Research

Diet

The Mediterranean diet is credited with lowering the risk of heart disease and early death.cite-ref-104[104]cite-ref-pmid18786971-105-0[105] The major contributors to mortality risk reduction appear to be a higher consumption of vegetables, fish, fruits, nuts and monounsaturated fatty acids, such as by consuming olive oil.cite-ref-degaetano2016-106-0[106]

As of 2021, there is insufficient clinical evidence that calorie restriction or any dietary practice affects the process of ageing.cite-ref-lee-107-0[107]

Exercise

People who participate in moderate to high levels of physical exercise have a lower mortality rate compared to individuals who are not physically active.cite-ref-108[108] The majority of the benefits from exercise are achieved with around 3500 metabolic equivalent (MET) minutes per week.cite-ref-bmj2016-109-0[109] For example, climbing stairs 10 minutes, vacuuming 15 minutes, gardening 20 minutes, running 20 minutes, and walking or bicycling for 25 minutes on a daily basis would together achieve about 3000 MET minutes a week.cite-ref-bmj2016-109-1[109]

Exercise has also been found to be an effective measure to treat declines in neuromuscular function due to age. cite-ref-0-110-0[110] A meta-analysis found that resistance training with elastic bands or kettlebells provided significant improvements to grip strength, gait speed, and skeletal muscle mass in patients with sarcopenia. cite-ref-0-110-1[110] Furthermore, another analysis found that the positive effects of resistance exercise on strength, muscle mass, and motor coordination reduce the risk of falls in the elderly, which is a key factor for living a longer and healthier life. cite-ref-1-111-0[111] In terms of programming, there is no one-size-fits-all approach. cite-ref-0-110-2[110]cite-ref-1-111-1[111] General recommendations for improvements to gait speed, strength, and muscle size for reduced fall risk are resistance training programs with two to three 40-60 minute workouts per week, consisting of 1-2 sets of 5-8 repetitions of 2-3 different exercises for each major muscle group, but individual considerations must be taken due to differences in health status, motivation, and accessibility to exercise facilities. cite-ref-0-110-3[110]cite-ref-1-111-2[111]

There is also evidence to suggest that exercise of any type may mitigate the degradation of the neuromuscular junction (NMJ) that occurs with age. cite-ref-2-112-0[112] Current evidence suggests that aerobic exercise causes the most hypertrophy of the NMJ, although resistance training is still somewhat effective.cite-ref-2-112-1[112] However, further evidence is necessary to identify optimal training protocols for NMJ function and to further understand how exercise affects the mechanisms that cause NMJ degradation.cite-ref-2-112-2[112]

Social factors

A meta-analysis showed that loneliness carries a higher mortality risk than smoking.cite-ref-holtlunstad2010-113-0[113]

Society and culture

Look up

quadragenarian

,

quinquagenarian

,

sexagenarian

,

septuagenarian

,

octogenarian

, or

nonagenarian

in Wiktionary, the free dictionary.

Different cultures express age in different ways. The age of an adult human is commonly measured in whole years since the day of birth. (The most notable exception—East Asian age reckoning—is becoming less common, particularly in official contexts.) Arbitrary divisions set to mark periods of life may include juvenile (from infancy through childhood, preadolescence, and adolescence), early adulthood, middle adulthood, and late adulthood. Informal terms include "tweens", "teenagers", "twentysomething", "thirtysomething", etc. as well as "denarian", "vicenarian", "tricenarian", "quadragenarian", etc.

Most legal systems define a specific age for when an individual is allowed or obliged to do particular activities. These age specifications include voting age, drinking age, age of consent, age of majority, age of criminal responsibility, marriageable age, age of candidacy, and mandatory retirement age. Admission to a movie, for instance, may depend on age according to a motion picture rating system. A bus fare might be discounted for the young or old. Each nation, government, and non-governmental organization has different ways of classifying age. In other words, chronological ageing may be distinguished from "social ageing" (cultural age-expectations of how people should act as they grow older) and "biological ageing" (an organism's physical state as it ages).cite-ref-114[114]

Ageism cost the United States $63 billion in one year according to a Yale School of Public Health study.cite-ref-115[115] In a UNFPA report about ageing in the 21st century, it highlighted the need to "Develop a new rights-based culture of ageing and a change of mindset and societal attitudes towards ageing and older persons, from welfare recipients to active, contributing members of society".cite-ref-ageing-in-the-twenty-first-century-116-0[116] UNFPA said that this "requires, among others, working towards the development of international human rights instruments and their translation into national laws and regulations and affirmative measures that challenge age discrimination and recognise older people as autonomous subjects".cite-ref-ageing-in-the-twenty-first-century-116-1[116] Older people's music participation contributes to the maintenance of interpersonal relationships and promoting successful ageing.cite-ref-117[117] At the same time, older persons can make contributions to society including caregiving and volunteering. For example, "A study of Bolivian migrants who [had] moved to Spain found that 69% left their children at home, usually with grandparents. In rural China, grandparents care for 38% of children aged under five whose parents have gone to work in cities."cite-ref-ageing-in-the-twenty-first-century-116-2[116]

Economics

Population ageing is the increase in the number and proportion of older people in society. Population ageing has three possible causes: migration, longer life expectancy (decreased death rate) and decreased birth rate. Ageing has a significant impact on society. Young people tend to have fewer legal privileges (if they are below the age of majority), they are more likely to push for political and social change, to develop and adopt new technologies, and to need education. Older people have different requirements from society and government, and frequently have differing values as well, such as for property and pension rights.cite-ref-vincent-2005-118-0[118]

In the 21st century, one of the most significant population trends is ageing.cite-ref-119[119] Currently, over 11% of the world's current population are people aged 60 and older and the United Nations Population Fund (UNFPA) estimates that by 2050 that number will rise to approximately 22%.cite-ref-ageing-in-the-twenty-first-century-116-3[116] Ageing has occurred due to development which has enabled better nutrition, sanitation, health care, education and economic well-being. Consequently, fertility rates have continued to decline and life expectancy has risen. Life expectancy at birth is over 80 now in 33 countries. Ageing is a "global phenomenon", that is occurring fastest in developing countries, including those with large youth populations, and poses social and economic challenges to the work which can be overcome with "the right set of policies to equip individuals, families and societies to address these challenges and to reap its benefits".cite-ref-unfpa-org-120-0[120]

As life expectancy rises and birth rates decline in developed countries, the median age rises accordingly. According to the United Nations, this process is taking place in nearly every country in the world.cite-ref-devrep05-121-0[121] A rising median age can have significant social and economic implications, as the workforce gets progressively older and the number of old workers and retirees grows relative to the number of young workers. Older people generally incur more health-related costs than do younger people in the workplace and can also cost more in worker's compensation and pension liabilities.cite-ref-aging-workforce-122-0[122] In most developed countries an older workforce is somewhat inevitable. In the United States for instance, the Bureau of Labor Statistics estimates that one in four American workers will be 55 or older by 2020.cite-ref-aging-workforce-122-1[122]

Among the most urgent concerns of older persons worldwide is income security. This poses challenges for governments with ageing populations to ensure investments in pension systems continues to provide economic independence and reduce poverty in old age. These challenges vary for developing and developed countries. UNFPA stated that, "Sustainability of these systems is of particular concern, particularly in developed countries, while social protection and old-age pension coverage remain a challenge for developing countries, where a large proportion of the labour force is found in the informal sector."cite-ref-ageing-in-the-twenty-first-century-116-4[116]

The global economic crisis has increased financial pressure to ensure economic security and access to health care in old age. To elevate this pressure "social protection floors must be implemented in order to guarantee income security and access to essential health and social services for all older persons and provide a safety net that contributes to the postponement of disability and prevention of impoverishment in old age".cite-ref-ageing-in-the-twenty-first-century-116-5[116]

It has been argued that population ageing has undermined economic developmentcite-ref-basakha-2015-123-0[123] and can lead to lower inflation because elderly individuals care especially strongly about the value of their pensions and savings. Evidence suggests that pensions, while making a difference to the well-being of older persons, also benefit entire families especially in times of crisis when there may be a shortage or loss of employment within households. A study by the Australian Government in 2003 estimated that "women between the ages of 65 and 74 years contribute A$16 billion per year in unpaid caregiving and voluntary work. Similarly, men in the same age group contributed A$10 billion per year."cite-ref-ageing-in-the-twenty-first-century-116-6[116]

Due to increasing share of the elderly in the population, health care expenditures will continue to grow relative to the economy in coming decades. This has been considered as a negative phenomenon and effective strategies like labour productivity enhancement should be considered to deal with negative consequences of ageing.cite-ref-basakha-2014-124-0[124]

Sociology

In the field of sociology and mental health, ageing is seen in five different views: ageing as maturity, ageing as decline, ageing as a life-cycle event, ageing as generation, and ageing as survival.cite-ref-125[125] Positive correlates with ageing often include economics, employment, marriage, children, education, and sense of control, as well as many others. The social science of ageing includes disengagement theory, activity theory, selectivity theory, and continuity theory. Retirement, a common transition faced by the elderly, may have both positive and negative consequences.cite-ref-126[126] As cyborgs currently are on the risecite-ref-127[127] some theorists argue there is a need to develop new definitions of ageing and for instance a bio-techno-social definition of ageing has been suggested.cite-ref-pmid25456627-128-0[128]

There is a current debate as to whether or not the pursuit of longevity and the postponement of senescence are cost-effective health care goals given finite health care resources. Because of the accumulated infirmities of old age, bioethicist Ezekiel Emanuel, opines that the pursuit of longevity via the compression of morbidity hypothesis is a "fantasy" and that human life is not worth living after age 75; longevity then should not be a goal of health care policy.cite-ref-emmanuel-129-0[129] This opinion has been contested by neurosurgeon and medical ethicist Miguel Faria, who states that life can be worthwhile during old age, and that longevity should be pursued in association with the attainment of quality of life.cite-ref-faria-75-130-0[130] Faria claims that postponement of senescence as well as happiness and wisdom can be attained in old age in a large proportion of those who lead healthy lifestyles and remain intellectually active.cite-ref-faria-longevity-131-0[131]

Health care demand

With age inevitable biological changes occur that increase the risk of illness and disability. UNFPA states that:cite-ref-unfpa-org-120-1[120]

"A life-cycle approach to health care – one that starts early, continues through the reproductive years and lasts into old age – is essential for the physical and emotional well-being of older persons, and, indeed, all people. Public policies and programmes should additionally address the needs of older impoverished people who cannot afford health care."

Many societies in Western Europe and Japan have ageing populations. While the effects on society are complex, there is a concern about the impact on health care demand. The large number of suggestions in the literature for specific interventions to cope with the expected increase in demand for long-term care in ageing societies can be organized under four headings: improve system performance; redesign service delivery; support informal caregivers; and shift demographic parameters.cite-ref-saltman2006-132-0[132]

However, the annual growth in national health spending is not mainly due to increasing demand from ageing populations, but rather has been driven by rising incomes, costly new medical technology, a shortage of health care workers and informational asymmetries between providers and patients.cite-ref-rheinhardt2003-133-0[133] A number of health problems become more prevalent as people get older. These include mental health problems as well as physical health problems, especially dementia.

It has been estimated that population ageing only explains 0.2 percentage points of the annual growth rate in medical spending of 4.3% since 1970. In addition, certain reforms to the Medicare system in the United States decreased elderly spending on home health care by 12.5% per year between 1996 and 2000.cite-ref-meara2004-134-0[134]

Self-perception

Beauty standards have evolved over time, and as scientific research in cosmeceuticals, cosmetic products seen to have medicinal benefits like anti-ageing creams, has increased, the industry has also expanded; the kinds of products they produce (such as serums and creams) have gradually gained popularity and become a part of many people's personal care routine.cite-ref-135[135]

The increase in demand for cosmeceuticals has led scientists to find ingredients for these products in unorthodox places. For example, the secretion of cryptomphalus aspersa (or brown garden snail) has been found to have antioxidant properties, increase skin cell proliferation, and increase extracellular proteins such as collagen and fibronectin (important proteins for cell proliferation).cite-ref-136[136] Another substance used to prevent the physical manifestations of ageing is onobotulinumtoxinA, the toxin injected for Botox.cite-ref-137[137]

In some cultures, old age is celebrated and honoured. In Korea, for example, a special party called hwangap is held to celebrate and congratulate an individual for turning 60 years old.cite-ref-138[138] In China, respect for elderly is often the basis for how a community is organized and has been at the foundation of Chinese culture and morality for thousands of years. Older people are respected for their wisdom and most important decisions have traditionally not been made without consulting them. This is a similar case for most Asian countries such as the Philippines, Thailand, Vietnam, Singapore, etc.

Positive self-perceptions of ageing are associated with better mental and physical health and well-being.cite-ref-sabatini2019-139-0[139] Positive self-perception of health has been correlated with higher well-being and reduced mortality among the elderly.cite-ref-idler2003-140-0[140]cite-ref-deeg2003-141-0[141] Various reasons have been proposed for this association; people who are objectively healthy may naturally rate their health better as than that of their ill counterparts, though this link has been observed even in studies which have controlled for socioeconomic status, psychological functioning and health status.cite-ref-benyamini2003-142-0[142] This finding is generally stronger for men than women,cite-ref-deeg2003-141-1[141] though this relationship is not universal across all studies and may only be true in some circumstances.cite-ref-benyamini2003-142-1[142]

As people age, subjective health remains relatively stable, even though objective health worsens.cite-ref-kunz2000-143-0[143] In fact, perceived health improves with age when objective health is controlled in the equation.cite-ref-144[144] This phenomenon is known as the "paradox of ageing". This may be a result of social comparison;cite-ref-145[145] for instance, the older people get, the more they may consider themselves in better health than their same-aged peers.cite-ref-146[146] Elderly people often associate their functional and physical decline with the normal ageing process.cite-ref-147[147]cite-ref-148[148]

One way to help younger people experience what it feels like to be older is through an ageing suit. There are several different kinds of suits including the GERT (named as a reference to gerontology), the R70i exoskeleton, and the AGNES (Age Gain Now Empathy Suit) suits.cite-ref-www-wbur-org-149-0[149]cite-ref-150[150]cite-ref-agelab-mit-edu-151-0[151] These suits create the feelings of the effects of ageing by adding extra weight and increased pressure in certain points like the wrists, ankles and other joints. In addition, the various suits have different ways to impair vision and hearing to simulate the loss of these senses. To create the loss of feeling in hands that the elderly experience, special gloves are a part of the uniforms.

Use of these suits may help to increase the amount of empathy felt for the elderly and could be considered particularly useful for those who are either learning about ageing, or those who work with the elderly, such as nurses or care centre staff.

Design is another field that could benefit from the empathy these suits may cause.cite-ref-www-wbur-org-149-1[149]cite-ref-agelab-mit-edu-151-1[151] When designers understand what it feels like to have the impairments of old age, they can better design buildings, packaging, or even tools to help with the simple day-to-day tasks that are more difficult with less dexterity. Designing with the elderly in mind may help to reduce the negative feelings that are associated with the loss of abilities that the elderly face.

Healthy ageing

The healthy ageing framework, proposed by the World Health Organization cite-ref-auto-152-0[152] operationalizes health as functional ability, which results from the interactions of intrinsic capacity and the environments.

Intrinsic capacity

Intrinsic capacity is a construct encompassing people's physical and mental abilities which can be drawn upon during ageing. cite-ref-auto-152-1[152] Intrinsic capacity comprises the domains of: cognition, locomotion, vitality/nutrition, psychological and sensory (visual and hearing). cite-ref-153[153]

A recent study found four "profiles" or "statuses" of intrinsic capacity among older adults, namely high IC (43% at baseline), low deterioration with impaired locomotion (17%), high deterioration without cognitive impairment (22%) and high deterioration with cognitive impairment (18%). Over half of the study sample remained in the same status at baseline and follow-up (61%). Around one-fourth of participants transitioned from the high IC to the low deterioration status, and only 3% of the participants improved their status. Interestingly, the probability of improvement was observed in the status of high deterioration. Participants in the latent statuses of low and high levels of deterioration had a significantly higher risk of frailty, disability and dementia than their high IC counterparts.cite-ref-154[154]

Successful ageing

The concept of successful ageing can be traced back to the 1950s and was popularized in the 1980s. Traditional definitions of successful ageing have emphasized absence of physical and cognitive disabilities.cite-ref-155[155] In their 1987 article, Rowe and Kahn characterized successful ageing as involving three components: a) freedom from disease and disability, b) high cognitive and physical functioning, and c) social and productive engagement.cite-ref-human-aging-usual-and-successful-156-0[156] The study cited previous was also done back in 1987 and therefore, these factors associated with successful ageing have probably been changed. With the current knowledge, scientists started to focus on learning about the effect of spirituality in successful ageing. There are some differences in cultures as to which of these components are the most important. Most often across cultures, social engagement was the most highly rated but depending on the culture the definition of successful ageing changes.cite-ref-157[157]

See also
References

cite-note-11. citerefliochev2015Liochev SI (December 2015). "Which Is the Most Significant Cause of Aging?". Antioxidants. 4 (4): 793–810. doi:10.3390/antiox4040793. PMC 4712935. PMID 26783959.
cite-note-22. "Understanding the Dynamics of the Aging Process". National Institute on Aging. Archived from the original on 10 June 2020. Retrieved 19 May 2021.
cite-note-33. citerefprakash1997Prakash IJ (October 1997). "Women & ageing". The Indian Journal of Medical Research. 106: 396–408. PMID 9361474.
cite-note-44. citerefgrey2007Grey, Aubrey D. N. J. de (21 December 2007). "Life Span Extension Research and Public Debate: Societal Considerations". Studies in Ethics, Law, and Technology. 1 (1). doi:10.2202/1941-6008.1011. ISSN 1941-6008.
cite-note-55. citerefmillerkaplan2007Miller, Freda D.; Kaplan, David R. (February 2007). "To Die or Not to Die: Neurons and p63". Cell Cycle. 6 (3): 312–317. doi:10.4161/cc.6.3.3795. PMID 17264677. S2CID 24939720.
cite-note-mortimer-1959-66. citerefmortimerjohnston1959Mortimer RK, Johnston JR (June 1959). "Life span of individual yeast cells". Nature. 183 (4677): 1751–2. Bibcode:1959Natur.183.1751M. doi:10.1038/1831751a0. hdl:2027/mdp.39015078535278. PMID 13666896. S2CID 4149521.
cite-note-nutman-2016-77. citerefnutmanbennettfriendvan-kranendonk2016Nutman AP, Bennett VC, Friend CR, Van Kranendonk MJ, Chivas AR (September 2016). "Rapid emergence of life shown by discovery of 3,700-million-year-old microbial structures". Nature (Submitted manuscript). 537 (7621): 535–538. Bibcode:2016Natur.537..535N. doi:10.1038/nature19355. PMID 27580034. S2CID 205250494.
cite-note-rose1991-88. citerefrose1991Rose MR (1991). Evolutionary Biology of Aging. New York: Oxford University Press.
cite-note-partridge1993-99. citerefpartridgebarton1993Partridge L, Barton NH (March 1993). "Optimality, mutation and the evolution of aging". Nature. 362 (6418): 305–11. Bibcode:1993Natur.362..305P. doi:10.1038/362305a0. PMID 8455716. S2CID 4330925.
cite-note-stewart2005-1010. citerefstewartmaddenpaultaddei2005Stewart EJ, Madden R, Paul G, Taddei F (February 2005). "Aging and death in an organism that reproduces by morphologically symmetric division". PLOS Biol. 3 (2): e45. doi:10.1371/journal.pbio.0030045. PMC 546039. PMID 15685293.
cite-note-1111. citerefackermannstearnsjenal2003Ackermann M, Stearns SC, Jenal U (June 2003). "Senescence in a bacterium with asymmetric division". Science. 300 (5627): 1920. doi:10.1126/science.1083532. PMID 12817142.
cite-note-1212. citerefsinclair2002Sinclair DA (April 2002). "Paradigms and pitfalls of yeast longevity research". Mech Ageing Dev. 123 (8): 857–67. doi:10.1016/s0047-6374(02)00023-4. PMID 12044934.
cite-note-1313. citerefjazwinski2002Jazwinski SM (2002). "Growing old: metabolic control and yeast aging". Annu Rev Microbiol. 56: 769–92. doi:10.1146/annurev.micro.56.012302.160830. PMID 12213938.
cite-note-williams1957-1414. citerefwilliams1957Williams GC (1957). "Pleiotropy, Natural Selection, and the Evolution of Senescence". Evolution. 11 (4): 398–411. doi:10.2307/2406060. JSTOR 2406060.
cite-note-pereirasmith1992-1515. citerefpereira-smithning1992Pereira-Smith OM, Ning Y (1992). "Molecular genetic studies of cellular senescence". Experimental Gerontology. 27 (5–6): 519–22. doi:10.1016/0531-5565(92)90006-L. PMID 1426085. S2CID 27839420.
cite-note-forster-2015-1616. citerefforsterhohoffdunkelmannsch-renkamp2015Forster P, Hohoff C, Dunkelmann B, Schürenkamp M, Pfeiffer H, Neuhuber F, Brinkmann B (March 2015). "Elevated germline mutation rate in teenage fathers". Proceedings. Biological Sciences. 282 (1803): 20142898. doi:10.1098/rspb.2014.2898. PMC 4345458. PMID 25694621.
cite-note-wakayama-2013-1717. citerefwakayamakohdaobokatatokoro2013Wakayama S, Kohda T, Obokata H, Tokoro M, Li C, Terashita Y, et al. (March 2013). "Successful serial recloning in the mouse over multiple generations". Cell Stem Cell. 12 (3): 293–7. doi:10.1016/j.stem.2013.01.005. PMID 23472871.
cite-note-hifreqaudiometry2014-1818. citerefrodr-guez-valientetrinidadgarc-a-berrocalg-rriz2014Rodríguez Valiente A, Trinidad A, García Berrocal JR, Górriz C, Ramírez Camacho R (August 2014). "Extended high-frequency (9–20 kHz) audiometry reference thresholds in 645 healthy subjects". International Journal of Audiology. 53 (8): 531–45. doi:10.3109/14992027.2014.893375. PMID 24749665. S2CID 30960789.
cite-note-191. citerefeducation-com2013Education.com (23 May 2013). "Sonic Science: The High-Frequency Hearing Test". Scientific American. Retrieved 25 May 2017.
cite-note-guardian2013-202. citerefmoss2013Moss S (July 2013). "Big ears: they really do grow as we age". The Guardian. MeshID:D000375; OMIM:502000. Retrieved 9 September 2016.
cite-note-age-dynamics-2121. citerefgerasimovignatov2004Gerasimov IG, Ignatov DY (2004). "Age Dynamics of Body Mass and Human Lifespan". Journal of Evolutionary Biochemistry and Physiology. 40 (3): 343–349. doi:10.1023/B:JOEY.0000042639.72529.e1. S2CID 9070790.
cite-note-thurstan-2012-2222. citerefthurstangibbslangtongriffiths2012Thurstan SA, Gibbs NK, Langton AK, Griffiths CE, Watson RE, Sherratt MJ (April 2012). "Chemical consequences of cutaneous photoageing". Chemistry Central Journal. 6 (1) 34. doi:10.1186/1752-153X-6-34. PMC 3410765. PMID 22534143.
cite-note-2323. "Infertility: Overview". InformedHealth.org. Cologne: Institute for Quality and Efficiency in Health Care. 25 March 2015 – via NCBI Bookshelf.
cite-note-2424. "Facts About Presbyopia". National Eye Institute. Archived from the original on 4 October 2016. Retrieved 11 September 2016.
cite-note-weale-2003-2525. citerefweale2003Weale RA (2003). "Epidemiology of refractive errors and presbyopia". Survey of Ophthalmology. 48 (5): 515–43. doi:10.1016/S0039-6257(03)00086-9. PMID 14499819.
cite-note-truscott-2009-2626. citereftruscott2009Truscott RJ (February 2009). "Presbyopia. Emerging from a blur towards an understanding of the molecular basis for this most common eye condition". Experimental Eye Research. 88 (2): 241–7. doi:10.1016/j.exer.2008.07.003. PMID 18675268.
cite-note-2727. citerefpathaishielslawncook2013Pathai S, Shiels PG, Lawn SD, Cook C, Gilbert C (March 2013). "The eye as a model of ageing in translational research—molecular, epigenetic and clinical aspects". Ageing Research Reviews. 12 (2): 490–508. doi:10.1016/j.arr.2012.11.002. PMID 23274270. S2CID 26015190.
cite-note-2828. citerefpandhikhanna2013Pandhi D, Khanna D (2013). "Premature graying of hair". Indian Journal of Dermatology, Venereology and Leprology. 79 (5): 641–53. doi:10.4103/0378-6323.116733. PMID 23974581.
cite-note-2929. citerefhamilton1951Hamilton JB (March 1951). "Patterned loss of hair in man; types and incidence". Annals of the New York Academy of Sciences. 53 (3): 708–28. Bibcode:1951NYASA..53..708H. doi:10.1111/j.1749-6632.1951.tb31971.x. PMID 14819896. S2CID 32685699.
cite-note-var2015-3030. citerefvary2015Vary JC (November 2015). "Selected Disorders of Skin Appendages--Acne, Alopecia, Hyperhidrosis". The Medical Clinics of North America. 99 (6): 1195–211. doi:10.1016/j.mcna.2015.07.003. PMID 26476248.
cite-note-3131. citerefmorabiacostanza1998Morabia A, Costanza MC (December 1998). "International variability in ages at menarche, first livebirth, and menopause. World Health Organization Collaborative Study of Neoplasia and Steroid Contraceptives". American Journal of Epidemiology. 148 (12): 1195–205. doi:10.1093/oxfordjournals.aje.a009609. PMID 9867266.
cite-note-thomas2014-3232. citerefthomaspeatcroft2014Thomas E, Peat G, Croft P (February 2014). "Defining and mapping the person with osteoarthritis for population studies and public health". Rheumatology. 53 (2): 338–45. doi:10.1093/rheumatology/ket346. PMC 3894672. PMID 24173433.
cite-note-3333. "Hearing Loss and Older Adults" (Last Updated 3 June 2016). National Institute on Deafness and Other Communication Disorders. 26 January 2016. Retrieved 11 September 2016.
cite-note-rubel2013-3434. citerefrubelfurrerstone2013Rubel EW, Furrer SA, Stone JS (March 2013). "A brief history of hair cell regeneration research and speculations on the future". Hearing Research. 297: 42–51. doi:10.1016/j.heares.2012.12.014. PMC 3657556. PMID 23321648.
cite-note-nih2009-3535. "Facts About Cataract". September 2015. Retrieved 14 August 2016.
cite-note-fried-2001-3636. citereffriedtangenwalstonnewman2001Fried LP, Tangen CM, Walston J, Newman AB, Hirsch C, Gottdiener J, et al. (March 2001). "Frailty in older adults: evidence for a phenotype". The Journals of Gerontology. Series A, Biological Sciences and Medical Sciences. 56 (3): M146-56. CiteSeerX 10.1.1.456.139. doi:10.1093/gerona/56.3.m146. PMID 11253156.
cite-note-3737. Percentage derived from Table 2 in Fried et al. 2001
cite-note-3838. citerefryallschertzerlynch2008Ryall JG, Schertzer JD, Lynch GS (August 2008). "Cellular and molecular mechanisms underlying age-related skeletal muscle wasting and weakness". Biogerontology. 9 (4): 213–28. doi:10.1007/s10522-008-9131-0. PMID 18299960. S2CID 8576449.
cite-note-3939. citerefbetikhepple2008Betik AC, Hepple RT (February 2008). "Determinants of VO2 max decline with aging: an integrated perspective". Applied Physiology, Nutrition, and Metabolism. 33 (1): 130–40. doi:10.1139/H07-174. PMID 18347663. S2CID 24468921.
cite-note-4040. citerefranganathansiemionowsahgalyue2001Ranganathan VK, Siemionow V, Sahgal V, Yue GH (November 2001). "Effects of aging on hand function". Journal of the American Geriatrics Society. 49 (11): 1478–84. doi:10.1046/j.1532-5415.2001.4911240.x. PMID 11890586. S2CID 22988219.
cite-note-wang-2012-4141. citerefwangbennett2012Wang JC, Bennett M (July 2012). "Aging and atherosclerosis: mechanisms, functional consequences, and potential therapeutics for cellular senescence". Circulation Research. 111 (2): 245–59. doi:10.1161/CIRCRESAHA.111.261388. PMID 22773427.
cite-note-wang-2016-4242. citerefherringtonlaceysherlikerarmitage2016Herrington W, Lacey B, Sherliker P, Armitage J, Lewington S (February 2016). "Epidemiology of Atherosclerosis and the Potential to Reduce the Global Burden of Atherothrombotic Disease". Circulation Research. 118 (4): 535–46. doi:10.1161/CIRCRESAHA.115.307611. PMID 26892956.
cite-note-4343. "The top 10 causes of death". WHO. 9 December 2020. Retrieved 11 March 2021.
cite-note-4444. "Does Human Life Span Really Have a Limit?". WebMD. 28 June 2018.
cite-note-nyt-20161005-4545. citerefzimmer2016Zimmer C (5 October 2016). "What's the Longest Humans Can Live? 115 Years, New Study Says". The New York Times. Retrieved 6 October 2016.
cite-note-nat-20151005-4646. citerefdongmilhollandvijg2016Dong X, Milholland B, Vijg J (October 2016). "Evidence for a limit to human lifespan". Nature. 538 (7624): 257–259. Bibcode:2016Natur.538..257D. doi:10.1038/nature19793. PMC 11673931. PMID 27706136. S2CID 3623127.
cite-note-larson2013-4747. citereflarsonyaffelanga2013Larson EB, Yaffe K, Langa KM (December 2013). "New insights into the dementia epidemic". The New England Journal of Medicine. 369 (24): 2275–7. doi:10.1056/nejmp1311405. PMC 4130738. PMID 24283198.
cite-note-4848. citerefumphred2012Umphred D (2012). Neurological rehabilitation (6th ed.). St. Louis, MO: Elsevier Mosby. p. 838. ISBN 978-0-323-07586-2.
cite-note-schaie2005-4949. citerefschaie2005Schaie KW (2005). Developmental Influences on Adult Intelligence. doi:10.1093/acprof:oso/9780195156737.001.0001. ISBN 978-0-19-515673-7.
cite-note-stuart-5050. citerefstuart-hamilton2006Stuart-Hamilton I (2006). The Psychology of Ageing: An Introduction. London: Jessica Kingsley Publishers. ISBN 978-1-84310-426-1.
cite-note-marner-5151. citerefmarnernyengaardtangpakkenberg2003Marner L, Nyengaard JR, Tang Y, Pakkenberg B (July 2003). "Marked loss of myelinated nerve fibers in the human brain with age". The Journal of Comparative Neurology. 462 (2): 144–52. doi:10.1002/cne.10714. PMID 12794739. S2CID 35293796.
cite-note-5252. citerefpeters2007Peters A (1 January 2007). "The Effects of Normal Aging on Nerve Fibers and Neuroglia in the Central Nervous System". In Riddle DR (ed.). Brain Aging: Models, Methods, and Mechanisms. Frontiers in Neuroscience. CRC Press/Taylor & Francis. ISBN 978-0-8493-3818-2. PMID 21204349.
cite-note-5353. citerefworrallhickson2003Worrall L, Hickson LM (2003). "Theoretical foundations of communication disability in aging". In Worrall L, Hickson LM (eds.). Communication disability in aging: from prevention to intervention. Clifton Park, NY: Delmar Learning. pp. 32–33.
cite-note-5454. citereflysbelangerphillips2019Lys R, Belanger E, Phillips SP (April 2019). "Improved mood despite worsening physical health in older adults: Findings from the International Mobility in Aging Study (IMIAS)". PLOS ONE. 14 (4): e0214988. Bibcode:2019PLoSO..1414988L. doi:10.1371/journal.pone.0214988. PMC 6453471. PMID 30958861.
cite-note-meh2015-5555. citerefmehta2015Mehta S (September 2015). "Age-Related Macular Degeneration". Primary Care. 42 (3): 377–91. doi:10.1016/j.pop.2015.05.009. PMID 26319344.
cite-note-nussbaum-j-f-1989-5656. citerefnussbaumthompsonrobinson1989Nussbaum JF, Thompson TL, Robinson JD (1989). "Barriers to conversation". In Nussbaum JF, Thompson TL, Robinson JD (eds.). Communication and aging. New York: Harper & Row. pp. 234–53.
cite-note-5757. "Cataracts | National Eye Institute". www.nei.nih.gov. Retrieved 3 July 2021.
cite-note-nei-nih-gov-5858. "Glaucoma | National Eye Institute". www.nei.nih.gov. Retrieved 3 July 2021.
cite-note-de-grey-2007-5959. citerefde-grey2007De Grey AD (2007). "Life Span Extension Research and Public Debate: Societal Considerations". Studies in Ethics, Law, and Technology. 1. CiteSeerX 10.1.1.395.745. doi:10.2202/1941-6008.1011. S2CID 201101995.
cite-note-lopez-2006-6060. citereflopezmathersezzatijamison2006Lopez AD, Mathers CD, Ezzati M, Jamison DT, Murray CJ (May 2006). "Global and regional burden of disease and risk factors, 2001: systematic analysis of population health data". Lancet. 367 (9524): 1747–57. doi:10.1016/S0140-6736(06)68770-9. PMID 16731270. S2CID 22609505.
cite-note-6161. Brunet Lab: Molecular Mechanisms of Longevity and Age Related Diseases. Stanford.edu. Retrieved on 11 April 2012.
cite-note-janssens-2015-6262. citerefjanssensmeinemagonz-lezwolters2015Janssens GE, Meinema AC, González J, et al. (December 2015). "Protein biogenesis machinery is a driver of replicative aging in yeast". eLife. 4 e08527. doi:10.7554/eLife.08527. PMC 4718733. PMID 26422514.
cite-note-rothmansingson2012-6363. citerefwilkinsontaylordillin2012Wilkinson DS, Taylor RC, Dillin A (2012). "Analysis of Aging". In Rothman JH, Singson A (eds.). Caenorhabditis Elegans: Cell Biology and Physiology. Academic Press. pp. 353–381. ISBN 978-0-12-394620-1.
cite-note-reis2009-6464. citerefshmookler-reisbharilltazearslanayyadevara2009Shmookler Reis RJ, Bharill P, Tazearslan C, Ayyadevara S (October 2009). "Extreme-longevity mutations orchestrate silencing of multiple signaling pathways". Biochimica et Biophysica Acta (BBA) - General Subjects. 1790 (10): 1075–1083. doi:10.1016/j.bbagen.2009.05.011. PMC 2885961. PMID 19465083.
cite-note-jin-2010-6565. citerefjin2010Jin K (October 2010). "Modern Biological Theories of Aging". Aging and Disease. 1 (2): 72–74. PMC 2995895. PMID 21132086.
cite-note-6666. citerefmelzerlensgennenvanneste2008Melzer S, Lens F, Gennen J, Vanneste S, Rohde A, Beeckman T (December 2008). "Flowering-time genes modulate meristem determinacy and growth form in Arabidopsis thaliana". Nature Genetics. 40 (12): 1489–92. doi:10.1038/ng.253. PMID 18997783. S2CID 13225884.
cite-note-bbc2017-oldestlivingthing-6767. citerefchesterton2017Chesterton M (12 June 2017). "The oldest living thing on Earth". BBC News. Retrieved 16 September 2017.
cite-note-oldest-6868. "Oldlist". Rocky Mountain Tree Ring Research. Retrieved 12 August 2016.
cite-note-sosnowska2014-6969. citerefsosnowskarichardsonsonntagcsiszar2014Sosnowska D, Richardson C, Sonntag WE, Csiszar A, Ungvari Z, Ridgway I (December 2014). "A heart that beats for 500 years: age-related changes in cardiac proteasome activity, oxidative protein damage and expression of heat shock proteins, inflammatory factors, and mitochondrial complexes in Arctica islandica, the longest-living noncolonial animal". The Journals of Gerontology. Series A, Biological Sciences and Medical Sciences. 69 (12): 1448–61. doi:10.1093/gerona/glt201. PMC 4271020. PMID 24347613.
cite-note-nielsen2016-7070. citerefnielsenhedeholmheinemeierbushnell2016Nielsen J, Hedeholm RB, Heinemeier J, Bushnell PG, Christiansen JS, Olsen J, et al. (August 2016). "Eye lens radiocarbon reveals centuries of longevity in the Greenland shark (Somniosus microcephalus)". Science. 353 (6300): 702–4. Bibcode:2016Sci...353..702N. doi:10.1126/science.aaf1703. hdl:2022/26597. PMID 27516602. S2CID 206647043.
cite-note-durkin2017-7171. citerefdurkinfishercordes2017Durkin A, Fisher CR, Cordes EE (August 2017). "Extreme longevity in a deep-sea vestimentiferan tubeworm and its implications for the evolution of life history strategies". Die Naturwissenschaften. 104 (7–8) 63. Bibcode:2017SciNa.104...63D. doi:10.1007/s00114-017-1479-z. PMID 28689349. S2CID 11287549.
cite-note-7272. Timiras, Paola S. (2003) Physiological Basis of Ageing and Geriatrics. Informa Health Care. ISBN 0-8493-0948-4. p. 26.
cite-note-7373. citerefsilverman2007Silverman J (5 July 2007). "Is there a 400 pound lobster out there?". howstuffworks.
cite-note-7474. citerefwallace2005Wallace DF (2005). Consider the Lobster and Other Essays. Little, Brown & Company. ISBN 978-0-316-15611-0.
cite-note-7575. citerefguerin2004Guerin JC (June 2004). "Emerging area of aging research: long-lived animals with "negligible senescence"". Annals of the New York Academy of Sciences. 1019 (1): 518–20. Bibcode:2004NYASA1019..518G. doi:10.1196/annals.1297.096. PMID 15247078. S2CID 6418634.
cite-note-7676. citerefdingzuozhangfan2025Ding, Yingjie; Zuo, Yuesheng; Zhang, Bin; Fan, Yanling; Xu, Gang; Cheng, Zhongyi; Ma, Shuai; Fang, Shuaiqi; Tian, Ao; Gao, Dandan; Xu, Xi; Wang, Qiaoran; Jing, Yaobin; Jiang, Mengmeng; Xiong, Muzhao (22 July 2025). "Comprehensive human proteome profiles across a 50-year lifespan reveal aging trajectories and signatures". Cell: S0092–8674(25)00749–4. doi:10.1016/j.cell.2025.06.047. ISSN 1097-4172. PMID 40713952.
cite-note-7777. citerefstarr2025Starr, Michelle (28 July 2025). "Study Reveals Turning Point When Your Body's Aging Accelerates". ScienceAlert. Retrieved 2 August 2025.
cite-note-7878. "Gauging Biological Age and Disease Risk with a Proteomic Clock | Harvard Medical School". hms.harvard.edu. 16 August 2024. Retrieved 2 August 2025.
cite-note-7979. citerefdingzuozhangfan2025Ding, Yingjie; Zuo, Yuesheng; Zhang, Bin; Fan, Yanling; Xu, Gang; Cheng, Zhongyi; Ma, Shuai; Fang, Shuaiqi; Tian, Ao; Gao, Dandan; Xu, Xi; Wang, Qiaoran; Jing, Yaobin; Jiang, Mengmeng; Xiong, Muzhao; Li, Jiaming; Han, Zichu; Sun, Shuhui; Wang, Si; He, Fuchu; Yang, Jiayin; Qu, Jing; Zhang, Weiqi; Liu, Guang-Hui (25 July 2025). "Comprehensive human proteome profiles across a 50-year lifespan reveal aging trajectories and signatures". Cell. doi:10.1016/j.cell.2025.06.047. ISSN 0092-8674.
cite-note-8080. citerefstarr2025Starr, Michelle (28 July 2025). "Study Reveals Turning Point When Your Body's Aging Accelerates". ScienceAlert. Retrieved 2 August 2025.
cite-note-8181. citerefmineglidulaisivamani2024Min, Mildred; Egli, Caitlin; Dulai, Ajay S.; Sivamani, Raja K. (13 December 2024). "Critical review of aging clocks and factors that may influence the pace of aging". Frontiers in Aging. 5 1487260. doi:10.3389/fragi.2024.1487260. ISSN 2673-6217.
cite-note-8282. citereffalcone2024Falcone, April (7 November 2024). "Biomarkers of Aging Transitions to the Proteomics Age". Alamar Biosciences. Retrieved 2 August 2025.
cite-note-8383. citerefsampaio-marquesburhansludovico2019Sampaio-Marques, Belém; Burhans, William C.; Ludovico, Paula (2019). "Yeast at the Forefront of Research on Ageing and Age-Related Diseases". Yeasts in Biotechnology and Human Health. Progress in Molecular and Subcellular Biology. Vol. 58. pp. 217–242. doi:10.1007/978-3-030-13035-0_9. hdl:1822/62308. ISBN 978-3-030-13034-3. ISSN 0079-6484. PMID 30911895. S2CID 85516879.
cite-note-8484. citerefgenslerbernstein1981Gensler HL, Bernstein H (September 1981). "DNA damage as the primary cause of aging". The Quarterly Review of Biology. 56 (3): 279–303. doi:10.1086/412317. JSTOR 2826464. PMID 7031747. S2CID 20822805.
cite-note-8585. citereffreitasde-magalh-es2011Freitas AA, de Magalhães JP (2011). "A review and appraisal of the DNA damage theory of ageing". Mutation Research. 728 (1–2): 12–22. Bibcode:2011MRRMR.728...12F. doi:10.1016/j.mrrev.2011.05.001. PMID 21600302.
cite-note-8686. citerefrobertlabat-robertrobert2010Robert L, Labat-Robert J, Robert AM (August 2010). "Genetic, epigenetic and posttranslational mechanisms of aging". Biogerontology. 11 (4): 387–99. doi:10.1007/s10522-010-9262-y. PMID 20157779. S2CID 21455794.
cite-note-8787. citerefsoarescortinhasbentoleit-o2014Soares JP, Cortinhas A, Bento T, Leitão JC, Collins AR, Gaivão I, Mota MP (June 2014). "Aging and DNA damage in humans: a meta-analysis study". Aging (Albany NY). 6 (6): 432–9. doi:10.18632/aging.100667. PMC 4100806. PMID 25140379.
cite-note-8888. citerefbeerman2017Beerman I (January 2017). "Accumulation of DNA damage in the aged hematopoietic stem cell compartment". Semin Hematol. 54 (1): 12–18. doi:10.1053/j.seminhematol.2016.11.001. PMC 5242379. PMID 28088982.
cite-note-8989. citerefvlachogiannisntourospappakravvariti2023Vlachogiannis NI, Ntouros PA, Pappa M, Kravvariti E, Kostaki EG, Fragoulis GE, Papanikolaou C, Mavroeidi D, Bournia VK, Panopoulos S, Laskari K, Arida A, Gorgoulis VG, Tektonidou MG, Paraskevis D, Sfikakis PP, Souliotis VL (April 2023). "Chronological Age and DNA Damage Accumulation in Blood Mononuclear Cells: A Linear Association in Healthy Humans after 50 Years of Age". Int J Mol Sci. 24 (8): 7148. doi:10.3390/ijms24087148. PMC 10138488. PMID 37108309.
cite-note-9090. citerefcaodengsonglian2024Cao H, Deng B, Song T, Lian J, Xia L, Chu X, Zhang Y, Yang F, Wang C, Cai Y, Diao Y, Kapranov P (May 2024). "Genome-wide profiles of DNA damage represent highly accurate predictors of mammalian age". Aging Cell. 23 (5) e14122. doi:10.1111/acel.14122. PMC 11113270. PMID 38391092.
cite-note-9191. citerefstrehler1986Strehler BL (1986). "Genetic instability as the primary cause of human aging". Experimental Gerontology. 21 (4–5): 283–319. doi:10.1016/0531-5565(86)90038-0. PMID 3545872. S2CID 34431271.
cite-note-9292. citerefgavrilovgavrilova2006Gavrilov LA, Gavrilova NA (2006). "Reliability Theory of Aging and Longevity". In Masoro EJ, Austad SN (eds.). Handbook of the Biology of Aging. San Diego, CA: Academic Press. pp. 3–42.
cite-note-carroll-2013-9393. citerefcarrollhewittkorolchuk2013Carroll B, Hewitt G, Korolchuk VI (2013). "Autophagy and ageing: implications for age-related neurodegenerative diseases". Essays in Biochemistry. 55: 119–31. doi:10.1042/bse0550119. PMID 24070476. S2CID 1603760.
cite-note-9494. citerefleekimcroteaubohr2020Lee JH, Kim EW, Croteau DL, Bohr VA (September 2020). "Heterochromatin: an epigenetic point of view in aging". Experimental & Molecular Medicine. 52 (9): 1466–1474. doi:10.1038/s12276-020-00497-4. PMC 8080806. PMID 32887933.
cite-note-9595. citereftsurumili2012Tsurumi A, Li WX (July 2012). "Global heterochromatin loss: a unifying theory of aging?". Epigenetics. 7 (7): 680–8. doi:10.4161/epi.20540. PMC 3414389. PMID 22647267.
cite-note-9696. citerefbjorkstentenhu1990Bjorksten J, Tenhu H (1990). "The crosslinking theory of aging—added evidence". Experimental Gerontology. 25 (2): 91–5. doi:10.1016/0531-5565(90)90039-5. PMID 2115005. S2CID 19115146.
cite-note-9797. citereftrifunoviclarsson2008Trifunovic A, Larsson NG (February 2008). "Mitochondrial dysfunction as a cause of ageing". Journal of Internal Medicine. 263 (2): 167–78. doi:10.1111/j.1365-2796.2007.01905.x. PMID 18226094. S2CID 28396237.
cite-note-9898. citerefharman1981Harman D (November 1981). "The aging process". Proceedings of the National Academy of Sciences of the United States of America. 78 (11): 7124–8. Bibcode:1981PNAS...78.7124H. doi:10.1073/pnas.78.11.7124. PMC 349208. PMID 6947277.
cite-note-9999. citerefschulzzarsevoigturban2007Schulz TJ, Zarse K, Voigt A, Urban N, Birringer M, Ristow M (October 2007). "Glucose restriction extends Caenorhabditis elegans life span by inducing mitochondrial respiration and increasing oxidative stress". Cell Metabolism. 6 (4): 280–93. doi:10.1016/j.cmet.2007.08.011. PMID 17908557.
cite-note-pmid11517304-100100. citerefhamiltonvan-remmendrakeyang2001Hamilton ML, Van Remmen H, Drake JA, Yang H, Guo ZM, Kewitt K, et al. (August 2001). "Does oxidative damage to DNA increase with age?". Proceedings of the National Academy of Sciences of the United States of America. 98 (18): 10469–74. Bibcode:2001PNAS...9810469H. doi:10.1073/pnas.171202698. PMC 56984. PMID 11517304.
cite-note-pmid15763395-101101. citerefwolffasanellatedescocavallini2005Wolf FI, Fasanella S, Tedesco B, Cavallini G, Donati A, Bergamini E, Cittadini A (March 2005). "Peripheral lymphocyte 8-OHdG levels correlate with age-associated increase of tissue oxidative DNA damage in Sprague-Dawley rats. Protective effects of caloric restriction". Experimental Gerontology. 40 (3): 181–8. doi:10.1016/j.exger.2004.11.002. PMID 15763395. S2CID 23752647.
cite-note-102102. citerefansonbohr2000Anson RM, Bohr VA (October 2000). "Mitochondria, oxidative DNA damage, and aging". Journal of the American Aging Association. 23 (4): 199–218. doi:10.1007/s11357-000-0020-y. PMC 3455271. PMID 23604866.
cite-note-vijg-103103. citerefvijg2021Vijg J (July 2021). "From DNA damage to mutations: All roads lead to aging". Ageing Research Reviews. 68 101316. doi:10.1016/j.arr.2021.101316. PMC 10018438. PMID 33711511.
cite-note-104104. citerefreestakedamartinellis2019Rees K, Takeda A, Martin N, Ellis L, Wijesekara D, Vepa A, et al. (Cochrane Heart Group) (March 2019). "Mediterranean-style diet for the primary and secondary prevention of cardiovascular disease". The Cochrane Database of Systematic Reviews. 2019 (3): CD009825. doi:10.1002/14651858.CD009825.pub3. PMC 6414510. PMID 30864165.
cite-note-pmid18786971-105105. citerefsoficesariabbategensini2008Sofi F, Cesari F, Abbate R, Gensini GF, Casini A (September 2008). "Adherence to Mediterranean diet and health status: meta-analysis". BMJ. 337 (sep11 2): a1344. doi:10.1136/bmj.a1344. PMC 2533524. PMID 18786971.
cite-note-degaetano2016-106106. citerefde-gaetano2016de Gaetano G (29 August 2016). "Mediterranean diet associated with lower risk of early death in cardiovascular disease patients. European Society of Cardiology". ScienceDaily.
cite-note-lee-107107. citerefleehillbittokaeberlein2021Lee MB, Hill CM, Bitto A, Kaeberlein M (November 2021). "Antiaging diets: Separating fact from fiction". Science. 374 (6570) eabe7365. doi:10.1126/science.abe7365. PMC 8841109. PMID 34793210.
cite-note-108108. citerefunited-states-department-of-health-and-human-services1996United States Department of Health And Human Services (1996). Physical activity and health: a report of the Surgeon General. United States Department of Health and Human Services. ISBN 978-1-4289-2794-0.
cite-note-bmj2016-109109. citerefkyubachmanalexandermumford2016Kyu HH, Bachman VF, Alexander LT, Mumford JE, Afshin A, Estep K, et al. (August 2016). "Physical activity and risk of breast cancer, colon cancer, diabetes, ischemic heart disease, and ischemic stroke events: systematic review and dose-response meta-analysis for the Global Burden of Disease Study 2013". BMJ. 354: i3857. doi:10.1136/bmj.i3857. PMC 4979358. PMID 27510511.
cite-note-0-110110. citerefzhaochengsongteng2022Zhao, Haotian; Cheng, Ruihong; Song, Ge; Teng, Jin; Shen, Siqin; Fu, Xuancheng; Yan, Yi; Liu, Chang (January 2022). "The Effect of Resistance Training on the Rehabilitation of Elderly Patients with Sarcopenia: A Meta-Analysis". International Journal of Environmental Research and Public Health. 19 (23): 15491. doi:10.3390/ijerph192315491. ISSN 1660-4601. PMC 9739568. PMID 36497565.
cite-note-1-111111. citerefrodriguesdomingosmonteiromorou-o2022Rodrigues, Filipe; Domingos, Christophe; Monteiro, Diogo; Morouço, Pedro (January 2022). "A Review on Aging, Sarcopenia, Falls, and Resistance Training in Community-Dwelling Older Adults". International Journal of Environmental Research and Public Health. 19 (2): 874. doi:10.3390/ijerph19020874. ISSN 1660-4601. PMC 8775372. PMID 35055695.
cite-note-2-112112. citerefwangcuizhanglin2024Wang, Qianjin; Cui, Can; Zhang, Ning; Lin, Wujian; Chai, Senlin; Chow, Simon Kwoon-Ho; Wong, Ronald Man Yeung; Hu, Yong; Law, Sheung Wai; Cheung, Wing-Hoi (1 May 2024). "Effects of physical exercise on neuromuscular junction degeneration during ageing: A systematic review". Journal of Orthopaedic Translation. 46: 91–102. doi:10.1016/j.jot.2024.03.007. ISSN 2214-031X. PMC 11137388. PMID 38817243.
cite-note-holtlunstad2010-113113. citerefholt-lunstadsmithlayton2010Holt-Lunstad J, Smith TB, Layton JB (July 2010). "Social relationships and mortality risk: a meta-analytic review". PLOS Medicine. 7 (7): e1000316. doi:10.1371/journal.pmed.1000316. PMC 2910600. PMID 20668659.
cite-note-114114. Phillips, Judith, Kristine Ajrouch, and Sarah Hillcoat-Nallétamby (2010) Key Concepts in Social Gerontology. SAGE Publications. ISBN 978-1-4462-0428-3. pp. 12–13.
cite-note-115115. citereflevysladechangkannoth2020Levy BR, Slade MD, Chang ES, Kannoth S, Wang SY (January 2020). "Ageism Amplifies Cost and Prevalence of Health Conditions". The Gerontologist. 60 (1): 174–181. doi:10.1093/geront/gny131. PMC 7182003. PMID 30423119.
cite-note-ageing-in-the-twenty-first-century-116116. "Ageing in the Twenty-First Century". UNFPA. 2012.
cite-note-117117. citereflo2015LO W (2015). "The music culture of older adults in Cantonese operatic singing lessons". Ageing and Society. 35 (8): 1614–34. doi:10.1017/S0144686X14000439. S2CID 144367063.
cite-note-vincent-2005-118118. citerefvincent2005Vincent JA (December 2005). "Understanding generations: political economy and culture in an ageing society". The British Journal of Sociology. 56 (4): 579–99. doi:10.1111/j.1468-4446.2005.00084.x. PMID 16309437. S2CID 1775770.
cite-note-119119. "Population Ageing and Development". UNFPA. 2002.
cite-note-unfpa-org-120120. "Ageing". unfpa.org. UNFPA – United Nations Population Fund.
cite-note-devrep05-121121. "UN Human Development Report 2005" (PDF). United Nations Development Programme. Archived from the original (PDF) on 27 May 2008. Retrieved 7 October 2010.
cite-note-aging-workforce-122122. citerefchosewood2012Chosewood LC (19 July 2012). "Safer and Healthier at Any Age: Strategies for an Aging Workforce". NIOSH Science Blog. National Institute for Occupational Safety and Health. Retrieved 6 August 2012.
cite-note-basakha-2015-123123. citerefbasakhayavarisadeghinaseri2015Basakha M, Yavari K, Sadeghi H, Naseri A (2015). "Population Aging And Iran's Non-Oil Economic Growth". Payavard Salamat. 9 (2): 131–46.
cite-note-basakha-2014-124124. citerefbasakhayavarisadeghinaseri2014Basakha M, Yavari K, Sadeghi H, Naseri A (2014). "Health care cost disease as a threat to Iranian aging society". Journal of Research in Health Sciences. 14 (2): 152–6. PMID 24728752.
cite-note-125125. citerefscheidbrown2010Scheid TL, Brown TN (2010). A Handbook for the Study of Mental Health (Second ed.). New York: Cambridge University Press.
cite-note-126126. citerefpanekhayslip1989Panek PE, Hayslip B (1989). Adult development and aging. San Francisco: Harper & Row. ISBN 978-0-06-045012-0.
cite-note-127127. citerefbarfield2015Barfield, Woodrow (2015). Cyber-humans : our future with machines. Cham. ISBN 978-3-319-25048-9.{{cite book}}: CS1 maint: location missing publisher (link)
cite-note-pmid25456627-128128. citerefwejbrandt2014Wejbrandt A (December 2014). "Defining aging in cyborgs: a bio-techno-social definition of aging". Journal of Aging Studies. 31: 104–9. doi:10.1016/j.jaging.2014.09.003. PMID 25456627.
cite-note-emmanuel-129129. citerefemmanuel-ej2014Emmanuel EJ (October 2014). "Why I hope to die at 75: An argument that society and families – and you – will be better off if nature takes its course swiftly and promptly". The Atlantic. Retrieved 7 April 2015.
cite-note-faria-75-130130. citereffaria2015Faria MA (2015). "Bioethics and why I hope to live beyond age 75 attaining wisdom!: A rebuttal to Dr. Ezekiel Emanuel's 75 age limit". Surgical Neurology International. 6: 35. doi:10.4103/2152-7806.152733. PMC 4360549. PMID 25789197.
cite-note-faria-longevity-131131. citereffaria2015Faria MA (2015). "Longevity and compression of morbidity from a neuroscience perspective: Do we have a duty to die by a certain age?". Surgical Neurology International. 6: 49. doi:10.4103/2152-7806.154273. PMC 4392568. PMID 25883841.
cite-note-saltman2006-132132. citerefsaltmanduboischawla2006Saltman RB, Dubois HF, Chawla M (2006). "The impact of aging on long-term care in Europe and some potential policy responses". International Journal of Health Services. 36 (4): 719–46. doi:10.2190/AUL1-4LAM-4VNB-3YH0. PMID 17175843. S2CID 45396303.
cite-note-rheinhardt2003-133133. citerefreinhardt2003Reinhardt UE (2003). "Does the aging of the population really drive the demand for health care?". Health Affairs. 22 (6): 27–39. doi:10.1377/hlthaff.22.6.27. PMID 14649430.
cite-note-meara2004-134134. citerefmearawhitecutler2004Meara E, White C, Cutler DM (2004). "Trends in medical spending by age, 1963–2000". Health Affairs. 23 (4): 176–83. doi:10.1377/hlthaff.23.4.176. PMID 15318578.
cite-note-135135. citerefkattimanitiwarigufranwasan2019Kattimani V, Tiwari RV, Gufran K, Wasan B, Shilpa PH, Khader AA (March 2019). "Botulinum Toxin Application in Facial Esthetics and Recent Treatment Indications (2013–2018)". Journal of International Society of Preventive & Community Dentistry. 9 (2): 99–105. doi:10.4103/jispcd.JISPCD_430_18. PMC 6489509. PMID 31058058. Standards of beauty have changed through centuries with increased awareness about esthetics.
cite-note-136136. citerefjuh-szlevinmarmur2018Juhász ML, Levin MK, Marmur ES (June 2018). "The use of natural ingredients in innovative Korean cosmeceuticals". Journal of Cosmetic Dermatology. 17 (3): 305–312. doi:10.1111/jocd.12492. PMID 29363245. S2CID 25982162.
cite-note-137137. "Botox injections – Mayo Clinic". www.mayoclinic.org. Retrieved 12 March 2021.
cite-note-138138. "Korea – Birthday Celebrations". www.asianinfo.org. Retrieved 12 March 2021.
cite-note-sabatini2019-139139. citerefsabatinisilarovamartyrcollins2020Sabatini S, Silarova B, Martyr A, Collins R, Ballard C, Anstey KJ, et al. (August 2020). "Associations of Awareness of Age-Related Change With Emotional and Physical Well-being: A Systematic Review and Meta-analysis". The Gerontologist. 60 (6): e477 – e490. doi:10.1093/geront/gnz101. PMC 7427487. PMID 31350849.
cite-note-idler2003-140140. citerefidler2003Idler EL (2003). "Discussion: Gender Differences in Self-Rated Health, in Mortality, and in the Relationship Between the Two". The Gerontologist. 43 (3): 372–75. doi:10.1093/geront/43.3.372.
cite-note-deeg2003-141141. citerefdeegbath2003Deeg DJ, Bath PA (June 2003). "Self-rated health, gender, and mortality in older persons: introduction to a special section". The Gerontologist. 43 (3): 369–71. doi:10.1093/geront/43.3.369. PMID 12810900.
cite-note-benyamini2003-142142. citerefbenyaminiblumsteinluskymodan2003Benyamini Y, Blumstein T, Lusky A, Modan B (June 2003). "Gender differences in the self-rated health-mortality association: is it poor self-rated health that predicts mortality or excellent self-rated health that predicts survival?". The Gerontologist. 43 (3): 396–405, discussion 372–5. doi:10.1093/geront/43.3.396. PMID 12810904.
cite-note-kunz2000-143143. citerefkunzmannlittlesmith2000Kunzmann U, Little TD, Smith J (September 2000). "Is age-related stability of subjective well-being a paradox? Cross-sectional and longitudinal evidence from the Berlin Aging Study". Psychology and Aging. 15 (3): 511–26. doi:10.1037/0882-7974.15.3.511. PMID 11014714.
cite-note-144144. citerefjylh-guralnikbalfourfried2001Jylhä M, Guralnik JM, Balfour J, Fried LP (October 2001). "Walking difficulty, walking speed, and age as predictors of self-rated health: the women's health and aging study". The Journals of Gerontology. Series A, Biological Sciences and Medical Sciences. 56 (10): M609-17. doi:10.1093/gerona/56.10.m609. PMID 11584033.
cite-note-145145. citerefheckhausen1999Heckhausen J (1999). Developmental Regulation in Adulthood: Age-Normative and Sociostructural Constraints as Adaptive Challenges. Cambridge University Press. ISBN 978-0-521-02713-7.
cite-note-146146. citerefsargent-coxansteyluszcz2008Sargent-Cox KA, Anstey KJ, Luszcz MA (September 2008). "Determinants of self-rated health items with different points of reference: implications for health measurement of older adults". Journal of Aging and Health. 20 (6): 739–61. doi:10.1177/0898264308321035. PMID 18625760. S2CID 34866893.
cite-note-147147. citerefidler1993Idler EL (November 1993). "Age differences in self-assessments of health: age changes, cohort differences, or survivorship?". Journal of Gerontology. 48 (6): S289-300. doi:10.1093/geronj/48.6.s289. PMID 8228003.
cite-note-148148. citerefwilliamsonfried1996Williamson JD, Fried LP (December 1996). "Characterization of older adults who attribute functional decrements to "old age"". Journal of the American Geriatrics Society. 44 (12): 1429–34. doi:10.1111/j.1532-5415.1996.tb04066.x. PMID 8951311. S2CID 21027678.
cite-note-www-wbur-org-149149. "40 Years In 5 Minutes: Age Simulation Suit Aims To Increase Empathy In Building Design". www.wbur.org. 3 June 2019. Retrieved 12 March 2021.
cite-note-150150. citerefprindle2016Prindle D (7 January 2016). "Hands on: Genworth R70i Exoskeleton". digitaltrends. Archived from the original on 8 January 2016. Retrieved 12 March 2021.
cite-note-agelab-mit-edu-151151. "AGNES (Age Gain Now Empathy System) | MIT AgeLab". agelab.mit.edu. Archived from the original on 6 April 2021. Retrieved 12 March 2021.
cite-note-auto-152152. citerefworld-health-organization2015World Health Organization (2015). World report on ageing and health. World Health Organization. hdl:10665/186463. ISBN 978-92-4-156504-2.
cite-note-153153. citerefgonz-lez-bautistade-souto-barretoandrieurolland2021González-Bautista, Emmanuel; de Souto Barreto, Philipe; Andrieu, Sandrine; et al. (August 2021). "Screening for intrinsic capacity impairments as markers of increased risk of frailty and disability in the context of integrated care for older people: Secondary analysis of MAPT". Maturitas. 150: 1–6. doi:10.1016/j.maturitas.2021.05.011. ISSN 1873-4111. PMID 34274071.
cite-note-154154. citerefgonzalez-bautistallibre-guerrasosaacosta2023Gonzalez-Bautista, Emmanuel; Llibre-Guerra, Jorge Jesus; Sosa, Ana L; et al. (1 July 2023). "Exploring the natural history of intrinsic capacity impairments: longitudinal patterns in the 10/66 study". Age and Ageing. 52 (7) afad137. doi:10.1093/ageing/afad137. ISSN 0002-0729. PMC 10387229. PMID 37517058.
cite-note-155155. citerefbaltesbaltes1990Baltes PB, Baltes MM (1990). "Psychological perspectives on successful aging: The model of selective optimization with compensation". In Baltes PB, Baltes MM (eds.). Successful Aging. pp. 1–34. doi:10.1017/CBO9780511665684.003. ISBN 978-0-511-66568-4.
cite-note-human-aging-usual-and-successful-156156. citerefrowekahn1987Rowe JW, Kahn RL (July 1987). "Human aging: usual and successful". Science. 237 (4811): 143–9. Bibcode:1987Sci...237..143R. doi:10.1126/science.3299702. PMID 3299702.
cite-note-157157. citerefjensenclaunchverdejadungan2018Jensen A, Claunch K, Verdeja M, Dungan M, Goates M, Thacker E (11 November 2018). "Successful Aging: Cross-Cultural Comparison of Older Adults' Lay Perspectives". Innovation in Aging. 2 (Suppl 1): 167. doi:10.1093/geroni/igy023.601. ISSN 2399-5300. PMC 6229246.